PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_01141A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 331aa    MW: 36110.2 Da    PI: 4.592
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_01141AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.71.6e-192370148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               rg+WT eEd+llv++v+ +G g+W++ ar  g++Rt+k+c++rw++yl
  Oropetium_20150105_01141A 23 RGPWTVEEDLLLVNYVATHGEGRWNSLARSAGLKRTGKSCRLRWLNYL 70
                               89********************************************97 PP

2Myb_DNA-binding51.81.8e-1676119146
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                rg+ T++E++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  Oropetium_20150105_01141A  76 RGNITPQEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 119
                                7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.6591874IPR017930Myb domain
SuperFamilySSF466892.43E-3121117IPR009057Homeodomain-like
SMARTSM007173.8E-162272IPR001005SANT/Myb domain
PfamPF002498.9E-182370IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-232477IPR009057Homeodomain-like
CDDcd001671.42E-122570No hitNo description
SMARTSM007176.2E-1575123IPR001005SANT/Myb domain
PROSITE profilePS5129418.87375125IPR017930Myb domain
PfamPF002492.2E-1576119IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-2378124IPR009057Homeodomain-like
CDDcd001672.27E-1180119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MDMAHERDAA SSEEEVMAGE LRRGPWTVEE DLLLVNYVAT HGEGRWNSLA RSAGLKRTGK  60
SCRLRWLNYL RPDLRRGNIT PQEQLLILEL HSRWGNRWSK IAQHLPGRTD NEIKNYWRTR  120
VQKHAKQLKC DVNSQRFKDV MRYLWMPRLV ERIQAAASAS GEQQLHAAAD ADTPLSSSWQ  180
NGADDGLYAS PELPADACWP AEYCPATGGL LATAAAVPEL SSTTAGSSSS PSMDSGAGAQ  240
PWPAPPGCGG ADWFTTACDA SSAAVVSMDL MSTQQPQEQP CPLGVGETTW ASEELPELGV  300
ADFEIGSFDV ESIWSMDDSL WYTQAAVQGV *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-251412318126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794340.0HF679434.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB28 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004984581.11e-173PREDICTED: transcription repressor MYB6-like
TrEMBLK4AA161e-171K4AA16_SETIT; Uncharacterized protein
STRINGSi035722m1e-171(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.11e-84myb domain protein 112